.
The Open Protein Structure Annotation Network
PDB Keyword
.

2re1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of aspartokinase alpha and beta subunits. To be Published
    Site MCSG
    PDB Id 2re1 Target Id APC90456.1
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5980,AAF41854.1, 122586 Molecular Weight 17722.08 Da.
    Residues 164 Isoelectric Point 4.67
    Sequence tfeeddnmeraavtgiafdknqarinvrgvpdkpgvayqilgavadanievdmiiqnvgsegttdfsft vprgdykqtleilserqdsigaasidgddtvckvsavglgmrshvgvaakifrtlaeeginiqmistse ikvsvlidekymelatrvlhkafnlg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.75 Rfree 0.27618
    Matthews' coefficent 2.51 Rfactor 0.23369
    Waters Solvent Content 51.01

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 2re1
    1. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of the regulatory domain of aspartokinase (Rv3709c) from Mycobacterium
    L Schuldt, R Suchowersky, K Veith - Section F: Structural , 2011 - scripts.iucr.org
     
    2. Applications of Bioinformatics to Protein Structures: How Protein Structure and Bioinformatics Overlap
    GW Han, C Rife, MR Sawaya - Methods in Molecular Biology, 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch