The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Phosphohistidine Phosphatase SixA from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2rfl Target Id APC5963
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4958,NP_532048.1, 176299 Molecular Weight 18588.86 Da.
    Residues 169 Isoelectric Point 4.92
    Sequence mtasfptrvyllrhakaawaapgerdfdrglneagfaeaeiiadlaadrryrpdlilsstaarcrqttq awqrafnegidivyidemynarsetylsliaaqtevqsvmlvghnptmeatleamigedllhaalpsgf ptsglavldqddsaasgknrwrlidflapgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.35 Rfree 0.283
    Matthews' coefficent 2.57 Rfactor 0.230
    Waters 581 Solvent Content 52.18

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch