.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b33

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of PAS domain of nitrogen regulation protein NR(II) from Vibrio parahaemolyticus. To be Published
    Site MCSG
    PDB Id 3b33 Target Id APC91440.4
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS6027,BAC58382.1, 3.30.450.20, 223926 Molecular Weight 12335.61 Da.
    Residues 112 Isoelectric Point 4.57
    Sequence mdtslpsailnnmvtatlilddglairyanpaaellfsqsakriveqslsqliqhasldlalltqplqs gqsitdsdvtfvvdgrplmlevtvspitwqrqlmllvemrkid
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.83 Rfree 0.1958
    Matthews' coefficent 2.49 Rfactor 0.1837
    Waters 70 Solvent Content 50.66

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch