.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b48

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of unknown function protein EF1359. To be Published
    Site MCSG
    PDB Id 3b48 Target Id APC29051
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5433,AAO81150, 226185 Molecular Weight 14181.06 Da.
    Residues 132 Isoelectric Point 4.24
    Sequence mkadillvshskmitdgikemieqmnaseeitihslggtsdgslgsdpmkiidtineadsdreflifad lgsavlsselafdmleedqqkhyhlvdaplvegafasaitagvsddltqilaeaqnagkkgwn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.21 Rfree 0.2463
    Matthews' coefficent 2.08 Rfactor 0.20074
    Waters 236 Solvent Content 40.92

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3b48
    1. Validation of crystallographic models containing TLS or other descriptions of anisotropy
    F Zucker, PC Champ, EA Merritt - Acta Crystallographica Section D: , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch