.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b49

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized conserved protein from Listeria innocua. To be Published
    Site MCSG
    PDB Id 3b49 Target Id APC87095
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS5876,CAC97418.1, BIG_860.1, 1642 Molecular Weight 24422.90 Da.
    Residues 208 Isoelectric Point 6.03
    Sequence mtekkidfkkeekkfyapkrkperifvpemnflmvdgkgdpdgeeyqkavqslyaiaytikmskmgetr ldgysdfvvpplegfwwsegkfdlkdrdawlwtsilrqpdfvteevlewakevarkkkpdvdtsrvklv rfeegecvqmmhvgpfseevhtvaemhqfmeteglrndtgairkhheiylsdprkanpekmktilrlpvs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.198
    Matthews' coefficent 2.38 Rfactor 0.170
    Waters 295 Solvent Content 48.39

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3b49
    1. The challenges of determining metalprotein affinities
    Z Xiao, AG Wedd - Nat. Prod. Rep., 2010 - pubs.rsc.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch