.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b4q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a conserved protein domain (unknown function) from Corynebacterium diphtheriae. To be Published
    Site MCSG
    PDB Id 3b4q Target Id APC90667.1
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS5988,CAE49293.1, 1717 Molecular Weight 9587.26 Da.
    Residues 91 Isoelectric Point 4.72
    Sequence lnsaptprdvvanapapvqaavagaqeyaaqaglnteelavdalynaikvrlagtglgippqieafyqa nrtnfngfymanrgaidfifsm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.2158
    Matthews' coefficent 2.25 Rfactor 0.18463
    Waters 200 Solvent Content 45.42

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch