.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b7h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the prophage Lp1 protein 11. To be Published
    Site MCSG
    PDB Id 3b7h Target Id APC88372
    Molecular Characteristics
    Source Lactobacillus plantarum wcfs1
    Alias Ids TPS5908,NP_784400.1, PF01381.12, 220668 Molecular Weight 8787.61 Da.
    Residues 78 Isoelectric Point 6.05
    Sequence mktdgefvsehlmelitqqnltinrvatlaglnqstvnamfegrskrptittirkvcgtlgisvhdffd fppynevek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.24945
    Matthews' coefficent 2.22 Rfactor 0.1956
    Waters 60 Solvent Content 44.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3b7h
    1. Native secondary structure topology has near minimum contact energy among all possible geometrically constrained topologies
    W Sun, J He - Proteins: Structure, Function, and Bioinformatics, 2009 - Wiley Online Library
     
    2. Topologies of surfaces on molecules and their computation in O (n) time
    DS Kim, Y Cho, J Ryu, CM Kim - Computer-Aided Design, 2010 - Elsevier
     
    3. Beta_decomposition for the volume and area of the union of three_dimensional balls and their offsets
    DS Kim, J Ryu, H Shin, Y Cho - Journal of Computational , 2012 - Wiley Online Library
     
    4. Periodic rigidity of protein crystal structures
    P Clark, J Grant, S Monastra - Advances in Bio and , 2012 - ieeexplore.ieee.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch