.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b85

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A structure of predicted phosphate starvation-induced ATPase PhoH2 from Corynebacterium glutamicum. TO BE PUBLISHED
    Site MCSG
    PDB Id 3b85 Target Id APC86075.2
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS5817,CAF20630.1, PF02562, 196627 Molecular Weight 22423.87 Da.
    Residues 205 Isoelectric Point 7.19
    Sequence virpktlgqkhyvdaidtntivfglgpagsgktylamakavqalqskqvsriiltrpaveageklgflp gtlnekidpylrplhdalrdmvepevipklmeagivevaplaymrgrtlndafvildeaqnttpaqmkm fltrlgfgskmvvtgditqvdlpggqksglrlvrhilrgvddvhfseltssdvvrhqlvghivdaye
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.234
    Matthews' coefficent 2.24 Rfactor 0.180
    Waters 49 Solvent Content 44.97

    Ligand Information
    Ligands SO4 (SULFATE) x 9
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch