.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b8b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of CysQ from Bacteroides thetaiotaomicron, a bacterial member of the inositol monophosphatase family. TO BE PUBLISHED
    Site MCSG
    PDB Id 3b8b Target Id APC81317
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS5651,AAO75518.1, 226186 Molecular Weight 29791.43 Da.
    Residues 268 Isoelectric Point 5.22
    Sequence maaidaalkagekilsiyedpksdfeierkadnspltiadrkaheaivailnetpfpvlseegkhmdya vrrgwdtlwivdpldgtkefikrngeftvnialvqnavpvmgviyvpvkkelyfavegtgaykcsgivg ledegvtlqqmieksermpladardhfiavasrshltpetetyiadlkkkhgnvelissgssikiclva egkadvyprfaptmewdtaaghaiaraagmevyqagkeeplrynkedllnpwfiveakrer
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.188
    Matthews' coefficent 2.72 Rfactor 0.166
    Waters 282 Solvent Content 54.76

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 3b8b
    1. Structural and biochemical characterization of the type II fructose-1, 6-bisphosphatase GlpX from Escherichia coli
    G Brown, A Singer, VV Lunin, M Proudfoot - Journal of Biological , 2009 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch