.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b8f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the cytidine deaminase from Bacillus anthracis. To be Published
    Site MCSG
    PDB Id 3b8f Target Id APC89128
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS5942,NP_845959.1, 198094 Molecular Weight 16355.79 Da.
    Residues 142 Isoelectric Point 5.19
    Sequence mnieqqlydvvkqlieqrypndwggaaairvedgtiytsvapdvinastelcmetgaileahkfqkkvt hsiclarenehselkvlspcgvcqerlfywgpevqcaitnakqdiifkplkelqpyhwteayhdemvke wstr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.19589
    Matthews' coefficent 2.46 Rfactor 0.1676
    Waters 413 Solvent Content 49.98

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3b8f
    1. Crystal structure determination and dynamic studies of Mycobacterium tuberculosis Cytidine deaminase in complex with products
    ZA Snchez-Quitian, LFSM Timmers - Archives of Biochemistry , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch