The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative YfrE protein from Vibrio parahaemolyticus. To be Published
    Site MCSG
    PDB Id 3bee Target Id APC91400.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS6025,NP_798310.1, 223926 Molecular Weight 10193.12 Da.
    Residues 90 Isoelectric Point 4.74
    Sequence vtatqlaakattlyylhkqamtdevsllleqalqlepyneaalsliandhfisfrfqeaidtwvlllds ndpnldrvtiiesinkakklm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.21447
    Matthews' coefficent 2.98 Rfactor 0.19093
    Waters 103 Solvent Content 58.78

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch