.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bhg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of adenylosuccinate lyase from Legionella pneumophila. To be Published
    Site MCSG
    PDB Id 3bhg Target Id APC86988
    Molecular Characteristics
    Source Legionella pneumophila subsp. pneumophila str. philadelphia 1
    Alias Ids TPS5872,AAU26889.1, BIG_589.1, 272624 Molecular Weight 51399.97 Da.
    Residues 456 Isoelectric Point 5.99
    Sequence mtltalnaispidgryvnktralspyfsefaltyyrlmveikwfeslaandtipevpaldnkarkflsd lisnfneseaekikefekqtnhdvkaveyylqdkfqeneqlkscvafihfactsedinnlayalmikqa iaqviqptiaeimgsitllgkqhadvamlsrthgqpatpttmgkelvnfvarlkrpqqqlaevlipakf ngavgnynahvaaypevdwrkhcanfvtslglsfnayttqiephdgiaevsqimvrinnilldytqdiw syislgyfkqktiaeevgsstmphkvnpidfenaegnlglsnalfihfankltqsrmqrdlsdstvlrn lgvafsysliayhsvakgndklqinksalqkdlsenwevlaeaiqtvmrrynepnayeqlkeltrgqmi daenlkkfiktlsipeeakaelmkltpetytglatqlvkafs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.19529
    Matthews' coefficent 2.24 Rfactor 0.1663
    Waters 273 Solvent Content 45.08

    Ligand Information
    Ligands SO4 (SULFATE) x 2;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3bhg
    1. Structure of Staphylococcus aureus adenylosuccinate lyase (PurB) and assessment of its potential as a target for structure-based inhibitor discovery
    PK Fyfe, A Dawson, MT Hutchison - Section D: Biological , 2010 - scripts.iucr.org
     
    2. Dimerization of the SARS coronavirus 3CL protease is controlled through long-range interactions
    JA Barrila - 2009 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch