.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bio

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of oxidoreductase (Gfo/Idh/MocA family member) from Porphyromonas gingivalis W83. To be Published
    Site MCSG
    PDB Id 3bio Target Id APC80872
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS5628,AAQ65966.1, 242619 Molecular Weight 32501.57 Da.
    Residues 301 Isoelectric Point 5.42
    Sequence mtddkkiraaivgygnigryalqalreapdfeiagivrrnpaevpfelqpfrvvsdieqlesvdvalvc spsrevertaleilkkgictadsfdihdgilalrrslgdaagksgaaaviasgwdpgsdsvvrtlmqai vpkgitytnfgpgmsmghtvavkaidgvkaalsmtiplgtgvhrrmvyvellpghnleevsaaikadey fvhdethviqvdevdalidmghgvrmvrkgvsgstqnqrmsfdmeinnpaltgqvlvcaaraamrqqpg aytlqeipvidllpgdreqwigklc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.187
    Matthews' coefficent 2.53 Rfactor 0.156
    Waters 433 Solvent Content 51.43

    Ligand Information
    Ligands EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 2;ACT (ACETATE) x 1;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3bio
    1. Inhibitory potency against human acetylcholinesterase and enzymatic hydrolysis of fluorogenic nerve agent mimics by human paraoxonase 1 and squid diisopropyl
    MM Blum, CM Timperley, GR Williams - Biochemistry, 2008 - ACS Publications
     
    2. Structure-activity analysis of aging and reactivation of human butyrylcholinesterase inhibited by analogues of tabun
    E Carletti, N Aurbek, E Gillon, M Loiodice, Y Nicolet - Biochem. J, 2009 - biochemj.org
     
    3. Effect of the ordered water on protein folding: An off-lattice G_-like model study
    G Zuo, J Hu, H Fang - Physical Review E, 2009 - APS
     
    4. Dual diaminopimelate biosynthesis pathways in Bacteroides fragilis and Clostridium thermocellum
    AO Hudson, A Klartag, C Gilvarg, RCJ Dobson - et Biophysica Acta (BBA , 2011 - Elsevier
     
    5. Protein Folding under Mediation of Ordering Water: an Off-Lattice G-Like Model Study
    Z Guang-Hong, H Jun, F Hai-Ping - Chinese Physics Letters, 2007 - iopscience.iop.org
     
    6. Characterization of the R263K Mutation in HIV-1 Integrase That Confers Low-Level Resistance to the Second-Generation Integrase Strand Transfer Inhibitor
    PK Quashie, T Mesplde, YS Han, M Oliveira - Journal of , 2012 - Am Soc Microbiol
     
    7. Discovery of novel human phenylethanolamine N-methyltransferase (hPNMT) inhibitors using 3D pharmacophore-Based in silico, biophysical screening and
    DI Kang, JY Lee, W Kim, KW Jeong, S Shin, J Yang - Molecules and , 2010 - Springer
     
    8. Theoretical Simulations of Scanning Probe Microscopy for Organic and Inorganic Materials
    M Tsukada, K Tagami, Q Gao - Current , 2007 - ingentaconnect.com
     
    9. Effect of the ordered water on protein folding: An off-lattice Go $ $($) over-bar-like model study
    GH Zuo, J Hu, HP Fang - 2009 - libsvr.sinap.ac.cn
     
    10. Single molecule imaging on living bacterial cell surface by high-speed AFM
    H Yamashita, A Taoka, T Uchihashi, T Asano - Journal of Molecular , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch