.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bjb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a TetR transcriptional regulator from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 3bjb Target Id APC7331
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS5117,RHA08568, 101510 Molecular Weight 22364.50 Da.
    Residues 203 Isoelectric Point 8.00
    Sequence vpriaevrdaaepsseeqrarhvrmleaaielatekelarvqmhevakragvaigtlyryfpskthlfv avmvdqidrmgvgfkksappgespqdavynvlvratrgllrrpalstamiqststanvasvpdagkvdr afrqimldaagiehpteedltalrllvqlwfgviqsclngrvsipdaesdirracdlllvnlshr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.27762
    Matthews' coefficent 2.51 Rfactor 0.23173
    Waters 18 Solvent Content 50.92

    Ligand Information
    Ligands SO4 (SULFATE) x 21
    Metals

    Jmol

     
    Google Scholar output for 3bjb
    1. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    2. Characterization of the KstR-dependent promoter of the gene for the first step of the cholesterol degradative pathway in Mycobacterium smegmatis
    I Uha, B Galn, FJ Medrano, JL Garca - Microbiology, 2011 - Soc General Microbiol
     
    3. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch