.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bjn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of C-terminal domain of putative transcriptional regulator from Vibrio cholerae. To be Published
    Site MCSG
    PDB Id 3bjn Target Id APC26855.2
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5369,AAF95943.1, 3.30.450.40, 243277 Molecular Weight 17881.72 Da.
    Residues 162 Isoelectric Point 9.40
    Sequence syetsqhnldaveavlsrlqkqtgemaaymvpvgyralcvsqresmqalrcsfvqgqsqpllrgasskv mlaympaarcekilryfgedptldkwqsefekirrhgyavstseidpgvsgisapvmkgskligaisvm apahrvesnkqriilhvlqaaral
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.20257
    Matthews' coefficent 2.84 Rfactor 0.1795
    Waters 200 Solvent Content 56.71

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch