.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bjo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of the C-terminal domain of a possible ATP-binding protein from Methanocaldococcus jannaschii DSM 2661. To be Published
    Site MCSG
    PDB Id 3bjo Target Id APC87992.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS5900,AAB99015.1, BIG_806, 243232 Molecular Weight 11834.56 Da.
    Residues 100 Isoelectric Point 9.25
    Sequence lkdvlnillmdeisklkdflsnldyikpkvnieeeiieirkediinalklfkgkyeievdkipkavyvy lvkknilflypqrgtlkpqsflvwnaikrvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.21686
    Matthews' coefficent 3.36 Rfactor 0.20275
    Waters 51 Solvent Content 63.35

    Ligand Information
    Ligands FMT (FORMIC) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch