.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bk5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of putative outer membrane lipoprotein-sorting protein domain from Vibrio parahaemolyticus. To be Published
    Site MCSG
    PDB Id 3bk5 Target Id APC87289.2
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS5879,NP_797666.1, BIG_1154.1, 223926 Molecular Weight 27103.17 Da.
    Residues 234 Isoelectric Point 8.06
    Sequence ekgleiaqerkardegwgdsiatmemilknaqgesstrlmrlkslevegdgdkgltifdqprdvtgtaf lnhshtigaddqwlylpalkrvkrissrnksgpfmgsefayedlssfeiekyrfnhlkdekfngqdvfv leqiptdknsgytkqvvwldkahyrplkvefydrkgallktltfanykqyldkywrahtmamtnhqtgk stelntsdlrfqtgleendfnknvlkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.22646
    Matthews' coefficent 2.35 Rfactor 0.17918
    Waters 203 Solvent Content 47.68

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch