The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MarR family transcriptional regulator. To be Published
    Site MCSG
    PDB Id 3boq Target Id APC88970
    Molecular Characteristics
    Source Silicibacter pomeroyi dss
    Alias Ids TPS5932,YP_164940.1, PF01047.13, 246200 Molecular Weight 16913.36 Da.
    Residues 157 Isoelectric Point 8.08
    Sequence mgeaatksdrqqnqtrlwlnilrlhglvfgdlnrqlldetglslakfdamaqlarnpdglsmgklsgal kvtngnvsglvnrlikdgmvvkamsaddrrsfsakltdaglttfkqaseahnrilaellravsdqdmve asaalrgilesmqtgasld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.39 Rfree 0.23296
    Matthews' coefficent 3.47 Rfactor 0.20287
    Waters 48 Solvent Content 64.54

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch