.
The Open Protein Structure Annotation Network
PDB Keyword
.

3brj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The mannitol operon repressor MtlR belongs to a new class of transcription regulators in bacteria. J.Biol.Chem. 284 36670-36679 2009
    Site MCSG
    PDB Id 3brj Target Id APC85967.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS5802,NP_796747.1, PF05068, 223926 Molecular Weight 19405.14 Da.
    Residues 172 Isoelectric Point 4.51
    Sequence madnineseiierlnsapsvrgffiatvdvfnesidgliqrifrkdnfavqsvvgpllqdsgplgdlsv rlkllfglgvlpddiyhdiediiklknhlnsdasdyeftdpnilepikklhlvkkmgmvqlevnepddd idlefyqlqlqrqqqiiksglslaiveicnelgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.75 Rfree 0.27272
    Matthews' coefficent 2.87 Rfactor 0.20679
    Waters 30 Solvent Content 57.07

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 4;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3brj
    1. Structure of the adenylylation domain of E. coli glutamine synthetase adenylyl transferase: evidence for gene duplication and evolution of a new active site
    Y Xu, PD Carr, SG Vasudevan, DL Ollis - Journal of molecular biology, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch