.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bv6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized metallo protein from Vibrio cholerae with beta-lactamase like fold. To be Published
    Site MCSG
    PDB Id 3bv6 Target Id APC26902
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5370,AAF96159, 243277 Molecular Weight 40463.82 Da.
    Residues 355 Isoelectric Point 5.45
    Sequence mskvneitreswilstfpewgtwlneeieqtvvepntfsmwwlgctgiwlksagntnlsidfwcgtgkk tqknrlmntqhqmmrmggvealqpnlrtsifpldpfaikeidavlashdhadhidvnvaaavlqncgeh vkfigpqacvdlwlgwgvpqercivakvgdvleigdvkirvldsfdrtalvtlpkgvssydkaildgmd eravnylietsggsvyhsgdshysnyyakhgndyqidvallsygenprgvtdkmtssdvlraaesldcq vvvpfhhdiwanfqndpreievlwnmkkdrlqyqfapffwqvggkytyptdkgrmhyqhfrgfqdifkn epelpykafl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.80 Rfree 0.20754
    Matthews' coefficent 2.48 Rfactor 0.16667
    Waters 2488 Solvent Content 50.37

    Ligand Information
    Ligands
    Metals FE (FE) x 12

    Jmol

     
    Google Scholar output for 3bv6
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Molecular Architecture of the Mn 2+-dependent Lactonase UlaG Reveals an RNase-like Metallo-_-lactamase Fold and a Novel Quaternary Structure
    F Garces, FJ Fernndez, C Montell - Journal of molecular , 2010 - Elsevier
     
    3. The UlaG protein family defines novel structural and functional motifs grafted on an ancient RNase fold
    FJ Fernandez, F Garces, M Lopez-Estepa - BMC evolutionary , 2011 - biomedcentral.com
     
    4. Mn2+_Dependent L_Ascorbate 6_Phosphate Lactonase
    FJ Fernandez, MC Vega - Encyclopedia of Inorganic and , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch