.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bwg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of possible transcriptional regulator YydK from Bacillus subtilis subsp. subtilis str. 168. To be Published
    Site MCSG
    PDB Id 3bwg Target Id APC85486
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS5774,CAB16050.1, PF07702, 224308 Molecular Weight 27277.67 Da.
    Residues 236 Isoelectric Point 5.34
    Sequence mlkyqqiateietyieehqlqqgdklpvletlmaqfevskstitkslelleqkgaifqvrgsgifvrkh krkgyisllsnqgfkkdledfnvtskvieldvrkptpeaaenlnigmdediyyvkrvryingqtlcyee syytksivtylnneivshsifhyireglglkigfsdlflhvgqlneeeaeylgleaglpklyiesifhl tngqpfdyskisynyeqsqfvvqansfll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.09 Rfree 0.22846
    Matthews' coefficent 2.33 Rfactor 0.18644
    Waters 288 Solvent Content 47.21

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 10
    Metals

    Jmol

     
    Google Scholar output for 3bwg
    1. Insight into the induction mechanism of the GntR/HutC bacterial transcription regulator YvoA
    M Resch, E Schiltz, F Titgemeyer - Nucleic acids , 2010 - Oxford Univ Press
     
    2. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of YvoA from Bacillus subtilis
    M Resch, HM Roth, M Kottmair, M Sevvana - Section F: Structural , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch