.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bwl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of PAS domain of HTR-like protein from Haloarcula marismortui. To be Published
    Site MCSG
    PDB Id 3bwl Target Id APC87707.1
    Molecular Characteristics
    Source Haloarcula marismortui atcc 43049
    Alias Ids TPS5892,AAV45155.1, 3.30.450.20, 272569 Molecular Weight 14406.18 Da.
    Residues 123 Isoelectric Point 4.48
    Sequence erkrrekrleetssrlealfenspdmidvldadgticevnqrfcaelgydesevlgrsiwefdlmfdae dvqtqlsgfsvderrkfeglyerrdgstmsvevhllrfnlegedrflaisrdit
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.73 Rfree 0.197
    Matthews' coefficent 2.04 Rfactor 0.159
    Waters 479 Solvent Content 39.83

    Ligand Information
    Ligands I3A (1H-INDOLE-3-CARBALDEHYDE) x 4
    Metals MG (MAGNESIUM) x 5

    Jmol

     
    Google Scholar output for 3bwl
    1. Structure and signaling mechanism of Per-ARNT-Sim domains
    A Mglich, RA Ayers, K Moffat - Structure, 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch