.
The Open Protein Structure Annotation Network
PDB Keyword
.

3byw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of an extracellular domain of arabinofuranosyltransferase from Corynebacterium diphtheriae. To be Published
    Site MCSG
    PDB Id 3byw Target Id APC90585.2
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS5983,CAE48662.1, 1717 Molecular Weight 18439.33 Da.
    Residues 174 Isoelectric Point 4.34
    Sequence pvnqvqssvswpqngslnsvsaplmsytpisfdakipvasvdklrkdqdlilgtlpansedagarglfv randdglqitshgelvldlskrelaqlpadatiaisatedettagiegddsttetverdvrpiimgiyt elesnaaadllnaglnahveinsrftssptlakyas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.35 Rfree 0.26315
    Matthews' coefficent 2.43 Rfactor 0.20888
    Waters 109 Solvent Content 49.38

    Ligand Information
    Ligands ACT (ACETATE) x 13
    Metals ZN (ZINC) x 19

    Jmol

     
    Google Scholar output for 3byw
    1. The C-terminal domain of the arabinosyltransferase Mycobacterium tuberculosis EmbC is a lectin-like carbohydrate binding module
    LJ Alderwick, GS Lloyd, H Ghadbane, JW May - PLoS , 2011 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch