.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bz6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a conserved protein of unknown function from Pseudomonas syringae pv. tomato str. DC3000. To be Published
    Site MCSG
    PDB Id 3bz6 Target Id APC84902
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS5750,AAO56188.1, PF04337, 223283 Molecular Weight 20001.73 Da.
    Residues 180 Isoelectric Point 5.61
    Sequence msiessatpttpnaealqlnstevrilgcliekqatnpetypltlnalviacnqktsrdpvmnltqgqv gqslralegrgltrlvmgsradrwehkvdkglelvpaqviltgllllrgpqtvselltrsnrmhdfeds eqvvhqlerliarglatlvprqsgqredrymhligdpedlqd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.21 Rfree 0.24085
    Matthews' coefficent 2.67 Rfactor 0.19574
    Waters 26 Solvent Content 53.87

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bz6
    1. Structure and Function of the Cardiac Stress Response Protein MS1
    CLF Fogl - 2011 - lra.le.ac.uk
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch