.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c0u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of E.coli yaeQ protein. To be Published
    Site MCSG
    PDB Id 3c0u Target Id APC27215
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS5380,AAP15723, 198215 Molecular Weight 20875.55 Da.
    Residues 181 Isoelectric Point 4.94
    Sequence malkatiykatvnvadldrnqfldasltlarhpsetqermmlrllawlkyaderlqftrglcaddepea wlrndhlgidlwielglpderrikkactqaaevalftynsraaqiwwqqnqskcvqfanlsvwylddeq lakvsafadrtmtlqatiqdgviwlsddknnlevnltawqqps
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.2342
    Matthews' coefficent 3.44 Rfactor 0.20954
    Waters 38 Solvent Content 64.21

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch