The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved putative LOR/SDH protein from Methanococcus maripaludis S2. To be Published
    Site MCSG
    PDB Id 3c2q Target Id APC87396.1
    Molecular Characteristics
    Source Methanococcus maripaludis s2
    Alias Ids TPS5883,CAF30774.1, BIG_908.1, 267377 Molecular Weight 37223.28 Da.
    Residues 342 Isoelectric Point 6.61
    Sequence nipeienanlkpalkdsvlpdgfysttnhpthvkvndewievanpkmdavivvypeekraetkvirkvk kgdfvlighngirvmppeksreagqlfefmnsevssekpkeaiikriakemheireeykktgtggiaiv ggpaiihtgggpalakmvelgyiqailagnalathdiesalygtslgvniktakpvtgghkhhiyaina indagniknavesgvlkegimyqciknnipyvlagsirddgpipdvitdsmvaqdkmrttvmdkkmvim lstllhsvatgnlmpsyiktvcvdiqpstvtklmdrgtsqaigvvtdvgvflvlllkelerlelqe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.21694
    Matthews' coefficent 3.79 Rfactor 0.19086
    Waters 320 Solvent Content 67.54

    Ligand Information
    Ligands IMD (IMIDAZOLE) x 4
    Metals NI (NICKEL) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch