.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c5p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of BAS0735, a protein of unknown function from Bacillus anthracis str. Sterne. To be Published
    Site MCSG
    PDB Id 3c5p Target Id APC61308
    Molecular Characteristics
    Source Bacillus anthracis str. sterne
    Alias Ids TPS5573,AAT53062.1, 260799 Molecular Weight 21701.34 Da.
    Residues 194 Isoelectric Point 4.99
    Sequence mtniikirasvfipmswteakmdmetgqviqfegdsreftphavntmrsrveqevvvdfykqevfsyan tgittekvispdgsvnkrtgkastenivctdivwnsggvqfkmsasasnplnvyappvdyvlnvcvkkd gsidvqgehdgfpcfefykqvdfgpfekiythdfretgdtaaalggnmdysftkrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.90 Rfree 0.226
    Matthews' coefficent 3.75 Rfactor 0.175
    Waters 238 Solvent Content 67.16

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 12

    Jmol

     
    Google Scholar output for 3c5p
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch