.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c6v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of AU4130/APC7354, a probable enzyme from the thermophilic fungus Aspergillus fumigatus. To be Published
    Site MCSG
    PDB Id 3c6v Target Id APC7354
    Molecular Characteristics
    Source Aspergillus fumigatus af293
    Alias Ids TPS5124,XP_748641.1, 330879 Molecular Weight 16111.54 Da.
    Residues 140 Isoelectric Point 5.93
    Sequence mprwliqhspntltpeekshlaqqitqayvgfglpafyvqvhfieqpagtsfiggeqhpnfvaltiyhl artmtsdeqrqgflkridafltpmfepkgidweyfvteaprdlwkinglappaagseeekvwvrenrpv rf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.90 Rfree 0.19689
    Matthews' coefficent 2.26 Rfactor 0.15734
    Waters 567 Solvent Content 45.58

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals CL (CHLORIDE) x 1;NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch