.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c7j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of transcriptional regulator (GntR family member) from Pseudomonas syringae pv. tomato str. DC3000. To be Published
    Site MCSG
    PDB Id 3c7j Target Id APC88642
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS5920,NP_795179.1, PF00392.11, 223283 Molecular Weight 27444.94 Da.
    Residues 245 Isoelectric Point 6.62
    Sequence mrksdreaflssvlgneqppahlartvieeklrnaiidgslpsgtalrqqelatlfgvsrmpvrealrq leaqsllrvethkgavvaplitedavdayalrillesealrlsiplldaddlaaaasyieqlevetdfg qigrlnrmfhlslyakthnkrlmrlveeglneeerflrfnlssmglgklsqddhwqllrlaeqkavepc vealqyhlnrgvqavtqylqsqkagnvkpartkkntpa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.227
    Matthews' coefficent 2.95 Rfactor 0.180
    Waters 354 Solvent Content 58.36

    Ligand Information
    Ligands
    Metals NI (NICKEL) x 2

    Jmol

     
    Google Scholar output for 3c7j
    1. Structure of Thermotoga maritima TM0439: implications for the mechanism of bacterial GntR transcription regulators with Zn2+-binding FCD domains
    M Zheng, DR Cooper, NE Grossoehme - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Crystal structure of Thermotoga maritima TM0439: implications for the mechanism of bacterial GntR transcription regulators with Zn2+-binding FCD domains
    M Zheng - 2009 - escholarship.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch