.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c85

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of TrkA domain of putative glutathione-regulated potassium-efflux KefB from Vibrio parahaemolyticus. To be Published
    Site MCSG
    PDB Id 3c85 Target Id APC90936.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS6002,NP_797206.1, 223926 Molecular Weight 20105.61 Da.
    Residues 180 Isoelectric Point 6.50
    Sequence plnrlghkiyqhsgkwlqetaaeklnqrdqlinpghaqvlilgmgrigtgaydelrarygkislgieir eeaaqqhrsegrnvisgdatdpdfwerildtghvklvllamphhqgnqtaleqlqrrnykgqiaaiaey pdqlegllesgvdaafniyseagsgfarhvckqlepqftsik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.23221
    Matthews' coefficent 1.90 Rfactor 0.18970
    Waters 268 Solvent Content 35.41

    Ligand Information
    Ligands SO4 (SULFATE) x 2;AMP (ADENOSINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3c85
    1. Mechanism of ligand-gated potassium efflux in bacterial pathogens
    TP Roosild, S Castronovo, J Healy - Proceedings of the , 2010 - National Acad Sciences
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch