.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c87

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri. To be Published
    Site MCSG
    PDB Id 3c87 Target Id APC27316
    Related PDB Ids 3c8d 3c8h 2b20 
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS5385,AAP16019, 198215 Molecular Weight 45605.54 Da.
    Residues 400 Isoelectric Point 5.76
    Sequence mtalkvgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqnsqpqsmq riagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqaiadplnpqswkgglg havsalempqaplqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvtaeerplavlldgefwaq smpvwpvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsdradrtv vagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagevsaeglrivleagire pmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglidlwqplfhdrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.17 Rfree 0.234
    Matthews' coefficent 2.19 Rfactor 0.190
    Waters 302 Solvent Content 43.72

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 3c87
    1. De novo designed proteins from a library of artificial sequences function in Escherichia coli and enable cell growth
    MA Fisher, KL McKinley, LH Bradley, SR Viola - PloS one, 2011 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch