.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c8m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of homoserine dehydrogenase from Thermoplasma volcanium. To be Published
    Site MCSG
    PDB Id 3c8m Target Id APC89447
    Related PDB Ids 3jsa 
    Molecular Characteristics
    Source Thermoplasma volcanium gss1
    Alias Ids TPS5951,BAB59531.1, 3.40.50.300.20, 273116 Molecular Weight 36622.37 Da.
    Residues 328 Isoelectric Point 5.26
    Sequence mktinlsifglgnvglnllriirsfneenrlglkfnvvfvadslhsyyneridigkvisykekgsldsl eyesisasealardfdivvdatpasadgkkelafyketfengkdvvtanksglanfwpeimeyarsnnr riryeatvaggvplfsfidysvlpsrikkfrgivsltinyfirelankrefddvlseatklgiveknyk ddltgldaarksvilcnhlygssyrlsdvfyegildqdrsfgknerlvtetgivngkpsaesrikslds ndylltlgkgslgyqlqtdtngtlnvsdlydgpyetagavmndlvilsmftv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.177
    Matthews' coefficent 2.76 Rfactor 0.156
    Waters 343 Solvent Content 55.47

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch