.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c9p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized protein SP1917. To be Published
    Site MCSG
    PDB Id 3c9p Target Id APC80642
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS5615,AAK75985, 170187 Molecular Weight 13843.35 Da.
    Residues 120 Isoelectric Point 8.49
    Sequence msqklynmkfaavylaliakverkggkaesvhqvtswltgyevsdvlacldrdvtygdffrqapyyvpe riaitgkicgvrieeiddplmqeirrldklvdwlakgktsqqvlekyekhk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.96 Rfree 0.21026
    Matthews' coefficent 2.18 Rfactor 0.163
    Waters 115 Solvent Content 43.55

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3c9p
    1. Automatch: Target_binding protein design and enzyme design by automatic pinpointing potential active sites in available protein scaffolds
    C Zhang, L Lai - Proteins: Structure, Function, and , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch