.
The Open Protein Structure Annotation Network
PDB Keyword
.

3can

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a domain of pyruvate-formate lyase-activating enzyme from Bacteroides vulgatus ATCC 8482. To be Published
    Site MCSG
    PDB Id 3can Target Id APC20359.1
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS5197,ABR39108.1, 435590 Molecular Weight 20701.82 Da.
    Residues 185 Isoelectric Point 5.87
    Sequence pfmdqsgggvtfcggepllhpeflidilkrcgqqgihravdttllarketvdevmrncelllidlksmd stvhqtfcdvpnelilknirrvaeadfpyyiripliegvnadekniklsaeflaslprhpeiinllpyh digkgkhaklgsiynpkgykmqtpseevqqqciqiltdyglkatigg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.182
    Matthews' coefficent 3.37 Rfactor 0.162
    Waters 174 Solvent Content 63.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3can
    1. 2-chlorovinyl tellurium dihalides,(p-tol) Te [C (H)= C (Cl) Ph] X2 for X= Cl, Br and I: variable coordination environments, supramolecular structures and docking
    I Caracelli, J Zukerman-Schpector, SH Maganhi - J. Braz. Chem. , 2010 - SciELO Brasil
     
    2. Comparative QSAR Analyses of a Series of Benzene Sulfonamide Inhibitors Based on Ab Initio MO Calculation of Their Complex Structures with Carbonic
    T Yoshida, M Youhei, H Chuman - 2008 - bukai.pharm.or.jp
     
    3. Structural Diversity in the AdoMet Radical Enzyme Superfamily
    DP Dowling, JL Vey, AK Croft, CL Drennan - Biochimica et Biophysica Acta , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch