.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ccy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a TetR-family transcriptional regulator from Bordetella parapertussis 12822. To be Published
    Site MCSG
    PDB Id 3ccy Target Id APC88698
    Molecular Characteristics
    Source Bordetella parapertussis 12822
    Alias Ids TPS5922,NP_885033.1, PF00440.13, 257311 Molecular Weight 23015.14 Da.
    Residues 200 Isoelectric Point 6.90
    Sequence martrsadyenirdtiieraaamfarqgysetsigdiaracecsksrlyhyfdskeavlrdmltthvds llercrqvlygsnepktrflqivklfleiyatsrdrhvvmltcldalpedqrkaliakqreliayvrda llqlrpdmaanrtlahvdtmlffgminwtytwykadgsvspdalaertvqlfldgylnllsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.01 Rfree 0.24183
    Matthews' coefficent 2.89 Rfactor 0.19826
    Waters 115 Solvent Content 57.37

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ccy
    1. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    2. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch