.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cdd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of prophage MuSo2, 43 kDa tail protein from Shewanella oneidensis. To be Published
    Site MCSG
    PDB Id 3cdd Target Id APC7502
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS5146,NP_718283.1, 211586 Molecular Weight 39280.63 Da.
    Residues 359 Isoelectric Point 5.36
    Sequence mseeivlkaggkiyqgwtkigitrsleamsgafdlemtykflgndaqykafiepikqgqactvdigger vitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtltqiadivckpfgikvivntdv gepfqriqieqgetphellarlakqrgvlltsdtfgnlvitrasktkagvslilgdnvkaargrfswrq rfskftikaagaahgqwdsaglptvggikadvtdseigryrpliivneevttaegaakrgqwerqrsig ksnmaeytvtgwripqtgklwnintlvpvideimgldeemliasilfseddagrlavisvvrpdamdip aqivkdtklggstw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.10 Rfree 0.25664
    Matthews' coefficent 2.49 Rfactor 0.20112
    Waters 1090 Solvent Content 50.51

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cdd
    1. Type VI secretion apparatus and phage tail-associated protein complexes share a common evolutionary origin
    PG Leiman, M Basler, UA Ramagopal - Proceedings of the , 2009 - National Acad Sciences
     
    2. Crystal structure of the N-terminal domain of the secretin GspD from ETEC determined with the assistance of a nanobody
    KV Korotkov, E Pardon, J Steyaert, WGJ Hol - Structure, 2009 - Elsevier
     
    3. A common evolutionary origin for tailed-bacteriophage functional modules and bacterial machineries
    D Veesler, C Cambillau - Microbiology and Molecular Biology , 2011 - Am Soc Microbiol
     
    4. The opening of the SPP1 bacteriophage tail, a prevalent mechanism in Gram-positive-infecting siphophages
    A Goulet, J Lai-Kee-Him, D Veesler, I Auzat - Journal of Biological , 2011 - ASBMB
     
    5. Phage Pierces the Host Cell Membrane with the Iron-Loaded Spike
    C Browning, MM Shneider, VD Bowman, D Schwarzer - Structure, 2012 - Elsevier
     
    6. Contractile Tail Machines of Bacteriophages
    PG Leiman, MM Shneider - Viral Molecular Machines, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch