.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cdh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the MarR family transcriptional regulator SPO1453 from Silicibacter pomeroyi. To be Published
    Site MCSG
    PDB Id 3cdh Target Id APC88689
    Molecular Characteristics
    Source Silicibacter pomeroyi dss
    Alias Ids TPS5921,YP_166694.1, PF01047.13, 246200 Molecular Weight 17045.54 Da.
    Residues 152 Isoelectric Point 7.95
    Sequence mndtpddtfvsgyllyllaasseeasaqfhdhiraqglrvpewrvlaclvdndammitrlaklslmeqs rmtrivdqmdarglvtrvadakdkrrvrvrltddgralaeslvasarahetrllsaladtdaarikgvl rtlldvldrpresr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.69 Rfree 0.22748
    Matthews' coefficent 4.42 Rfactor 0.20019
    Waters 113 Solvent Content 72.19

    Ligand Information
    Ligands SO4 (SULFATE) x 6;GOL (GLYCEROL) x 3
    Metals

    Jmol

     
    Google Scholar output for 3cdh
    1. Structure of the Archaeoglobus fulgidus orphan ORF AF1382 determined by sulfur SAD from a moderately diffracting crystal
    JY Zhu, ZQ Fu, L Chen, H Xu, J Chrzas - Section D: Biological , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch