.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cdk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the co-expressed succinyl-CoA transferase A and B complex from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 3cdk Target Id APC152
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4459,P42316, 1423 Molecular Weight 23329.72 Da.
    Residues 216 Isoelectric Point 5.07
    Sequence mkearkrmvkravqeikdgmnvnlgigmptlvaneipdgvhvmlqsengllgigpyplegtedadlina gketitevtgasyfdsaesfamirgghidlailggmevseqgdlanwmipgkmvkgmggamdlvngakr ivvimehvnkhgeskvkktcslpltgqkvvhrlitdlavfdfvngrmtltelqdgvtieevyekteadf avsqsvlns
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.59 Rfree 0.25278
    Matthews' coefficent 2.33 Rfactor 0.19257
    Waters 115 Solvent Content 47.13

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cdk
    1. SYSTEM AND USES FOR GENERATING DATABASES OF PROTEIN SECONDARY STRUCTURES INVOLVED IN INTER-CHAIN PROTEIN INTERACTIONS
    AL Jochim, PS Arora - US Patent App. 12/753,638, 2010 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch