.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ced

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of the C-terminal NIL domain of an ABC transporter protein homologue from Staphylococcus aureus. TO BE PUBLISHED
    Site MCSG
    PDB Id 3ced Target Id APC87061.1
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mu50
    Alias Ids TPS5875,BAB56999.1, BIG_1104.4, 158878 Molecular Weight 10687.65 Da.
    Residues 95 Isoelectric Point 4.92
    Sequence ddfetslteleplekdayivrlvfagstttepivsslstaydikinileanikntkngtvgflvlhipy issvdfgkfekelierqvkmevlrhg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.15 Rfree 0.215
    Matthews' coefficent 4.39 Rfactor 0.184
    Waters 323 Solvent Content 71.97

    Ligand Information
    Ligands BU1 (1,4-BUTANEDIOL) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch