.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ci6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the GAF domain from Acinetobacter phosphoenolpyruvate-protein phosphotransferase. TO BE PUBLISHED
    Site MCSG
    PDB Id 3ci6 Target Id APC87504.2
    Molecular Characteristics
    Source Acinetobacter sp. adp1
    Alias Ids TPS5884,CAG67390.1, 3.30.450.40, 62977 Molecular Weight 18645.36 Da.
    Residues 168 Isoelectric Point 5.05
    Sequence msnmqldtlrrivqeinssvslhdsldimvnqvadamkvdvcsiylldernqryllmaskglnpesvgh vslqlseglvglvgqreeivnlenaskherfaylpetgeeiynsflgvpvmyrrkvmgvlvvqnkqpqd fseaaesflvtlcaqlsgviahahavgnid
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.196
    Matthews' coefficent 1.73 Rfactor 0.168
    Waters 285 Solvent Content 28.90

    Ligand Information
    Ligands P4G (1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE) x 2;PEG (DI(HYDROXYETHYL)ETHER) x 2;GOL (GLYCEROL) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch