.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cit

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the GAF domain of a putative sensor histidine kinase from Pseudomonas syringae pv. tomato. To be Published
    Site MCSG
    PDB Id 3cit Target Id APC87806.2
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS5897,AAO55648.1, 3.30.450.40, 223283 Molecular Weight 17066.56 Da.
    Residues 157 Isoelectric Point 5.54
    Sequence yrqsqsraarlrllvdtgqeliqlppeamrkcvlqracafvamdhglllewgadngvqttarhgskerl stlettadplaigpqwlerpgthlpcvlllplrgadegsfgtlvlansvaisapdgedieslqllatll aahlennrllealvardrt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.200
    Matthews' coefficent 3.23 Rfactor 0.165
    Waters 324 Solvent Content 61.96

    Ligand Information
    Ligands SO4 (SULFATE) x 4;GOL (GLYCEROL) x 6;EDO (1,2-ETHANEDIOL) x 2;BME (BETA-MERCAPTOETHANOL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3cit
    1. Structure and signaling mechanism of Per-ARNT-Sim domains
    A Mglich, RA Ayers, K Moffat - Structure, 2009 - Elsevier
     
    2. Sensor domains of two-component regulatory systems
    J Cheung, WA Hendrickson - Current opinion in microbiology, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch