The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MarR family transcriptional regulator from Silicibacter pomeroyi. To be Published
    Site MCSG
    PDB Id 3cjn Target Id APC88806
    Molecular Characteristics
    Source Silicibacter pomeroyi dss
    Alias Ids TPS5926,YP_166699.1, PF01047.13, 246200 Molecular Weight 17804.45 Da.
    Residues 159 Isoelectric Point 8.07
    Sequence maestdqteqlrelaeiglegyapylmnrimgrynanlrkemtalglstakmralailsakdglpigtl gifavveqstlsraldglqadglvrrevdsddqrssrvyltpagravydrlwphmrashdrmfqgitpq erqaflatlnkmlanirvhei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.22257
    Matthews' coefficent 2.26 Rfactor 0.17912
    Waters 142 Solvent Content 45.62

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch