.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ck6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and electrostatic property of cytoplasmic domain of ZntB transporter. Protein Sci. 18 2043-2052 2009
    Site MCSG
    PDB Id 3ck6 Target Id APC91421.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS6026,NP_798768.1, 223926 Molecular Weight 29019.09 Da.
    Residues 249 Isoelectric Point 5.34
    Sequence mgfmiehwdfstpmatqetttaehiqpnhwyhcerlhpdirswlednhvpratvdhlladesrpsfhpl dddnfmlilrginmnenaspedmlsirilyfqgalistrkipsraimeirqalaehkgpkslasllnqi ieglngkidlyldtieetlnefdvndestynhiaaqkalisikrfirpqqyairdlieseselvtsrph qyrfahnnitrinetiefylgevalfqdeikhnrdektnkns
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 1.90 Rfree 0.22347
    Matthews' coefficent 2.18 Rfactor 0.1849
    Waters 670 Solvent Content 43.65

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 25

    Jmol

     
    Google Scholar output for 3ck6
    1. The unique nature of Mg2+ channels
    AS Moomaw, ME Maguire - Physiology, 2008 - Am Physiological Soc
     
    2. Structure and electrostatic property of cytoplasmic domain of ZntB transporter
    K Tan, A Sather, JL Robertson, S Moy, B Roux - Protein , 2009 - Wiley Online Library
     
    3. X-Ray Crystallography and Isothermal Titration Calorimetry Studies of the Salmonella Zinc Transporter ZntB
    Q Wan, MF Ahmad, J Fairman, B Gorzelle - Structure, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch