.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ckd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the Shigella T3SS effector IpaH defines a new class of E3 ubiquitin ligases. Nat.Struct.Mol.Biol. 15 1293-1301 2008
    Site MCSG
    PDB Id 3ckd Target Id APC7291
    Molecular Characteristics
    Source Shigella flexneri 2a str. 301
    Alias Ids TPS5109,NP_858398.2, 198214 Molecular Weight 35215.19 Da.
    Residues 311 Isoelectric Point 4.79
    Sequence gpqiffsmgnsatisapehsladavtawfpenkqsdvsqiwhafeheehantfsafldrlsdtvsarnt sgfreqvaawleklsasaelrqqsfavaadatescedrvaltwnnlrktllvhqaseglfdndtgalls lgremfrleilediardkvrtlhfvdeievylafqtmlaeklqlstavkemrfygvsgvtandlrtaea mvrsreeneftdwfslwgpwhavlkrteadrwaqaeeqkyemleneysqrvadrlkasglsgdadaere agaqvmreteqqiyrqltdevlalrlsengsnhia
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.65 Rfree 0.28382
    Matthews' coefficent 2.75 Rfactor 0.2281
    Waters 24 Solvent Content 55.24

    Ligand Information
    Ligands SO4 (SULFATE) x 2;GOL (GLYCEROL) x 3;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals

    Jmol

     
    Google Scholar output for 3ckd
    1. Structure of a Shigella effector reveals a new class of ubiquitin ligases
    Y Zhu, H Li, L Hu, J Wang, Y Zhou, Z Pang - Nature structural & , 2008 - nature.com
     
    2. Structure of the Shigella T3SS effector IpaH defines a new class of E3 ubiquitin ligases
    AU Singer, JR Rohde, R Lam, T Skarina - Nature structural & , 2008 - nature.com
     
    3. Hijacking the host ubiquitin pathway: structural strategies of bacterial E3 ubiquitin ligases
    SW Hicks, JE Galn - Current opinion in microbiology, 2010 - Elsevier
     
    4. The many faces of the YopM effector from plague causative bacterium Yersinia pestis and its implications for host immune modulation
    V Soundararajan, N Patel, V Subramanian - Innate , 2011 - ini.sagepub.com
     
    5. A disulfide driven domain swap switches off the activity of Shigella IpaH9. 8 E3 ligase
    A Seyedarabi, JA Sullivan, C Sasakawa - FEBS letters, 2010 - Elsevier
     
    6. The orchestrators of Shigella flexneri infection
    A Seyedarabi - Crystallography Reviews, 2010 - Taylor & Francis
     
    7. Conserved Structural Mechanisms for Autoinhibition in IpaH Ubiquitin Ligases
    YC Chou, AFA Keszei, JR Rohde, M Tyers - Journal of Biological , 2012 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch