.
The Open Protein Structure Annotation Network
PDB Keyword
.

3clq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a conserved protein of unknown function from Enterococcus faecalis V583. To be Published
    Site MCSG
    PDB Id 3clq Target Id APC29596.3
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5464,AAO82696.1, BIG_561.1, 226185 Molecular Weight 44705.88 Da.
    Residues 418 Isoelectric Point 4.86
    Sequence ptlyekiqqaneeavtriiqskpilvgfdkainvmpdmtettilhagppityenmcgpmkgavqgalvf eglakdladadrvarsgaitfspchehdavgsmagvtspnmyvhiiknetygntaftnlseqlakvlrf gandqsvvdrliwmrdvlgpllhdamtfcpegidlrlmlsqalhmgdechnrnvagstllvqaltpymv qtdfsreqlkevfeflgssdyfsgptwmgaakcaldaghnvenstivttmcrngvefgirvsgiggnhw ftgpaqrvigpmfagytqedagldmgdsaitetygvggfamaaapaivplvggtvaealnyskemleit tkenpnvtipvldfmgiptgidvlkvletgmlpvintaiahkepgigmigagltnppanvfnealkalvatin
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.23972
    Matthews' coefficent 2.79 Rfactor 0.18322
    Waters 49 Solvent Content 55.88

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch