.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cne

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the putative protease I from Bacteroides thetaiotaomicron. To be Published
    Site MCSG
    PDB Id 3cne Target Id APC81499
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS5656,AAO76370.1, 226186 Molecular Weight 19149.18 Da.
    Residues 175 Isoelectric Point 5.04
    Sequence makkvavlavnpvngcglfqyleaffengisykvfavsdtkeiktnsgmvlivddvianlkghedefda lvfscgdavpvfqqyanqpynvdlmeviktfgekgkmmighcagammfdftgitkgkkvavhplakpai qngiatdekseidgnfftaqdentiwtmlpkviealk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.99 Rfree 0.23441
    Matthews' coefficent 2.27 Rfactor 0.18593
    Waters 371 Solvent Content 45.84

    Ligand Information
    Ligands FMN (FLAVIN) x 2
    Metals CA (CALCIUM) x 4;ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 3cne
    1. Flavogenomicsa genomic and structural view of flavin_dependent proteins
    P Macheroux, B Kappes, SE Ealick - FEBS Journal, 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch