.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cni

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Domain of a Putative ABC Type-2 Transporter from Thermotoga maritima MSB8. To be Published
    Site MCSG
    PDB Id 3cni Target Id APC7623
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS5173,AAD35628.1, 243274 Molecular Weight 17022.62 Da.
    Residues 156 Isoelectric Point 5.77
    Sequence kstvekstvgqkvaivredtgtiaelaekalgnmvdivyagsdlkeaeeavkkekapaiivipkgfsqs lesgekarleivwylrgtglseavstgtisslieslkvqlasfllndpkkaqllfdpleivqhtylrgs lfknhspeaimnvfysqn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.227
    Matthews' coefficent 2.56 Rfactor 0.204
    Waters 31 Solvent Content 51.93

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch