.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cnu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the predicted coding region AF_1534 from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 3cnu Target Id APC7557
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS5154,AAB89715.1, 224325 Molecular Weight 13153.44 Da.
    Residues 116 Isoelectric Point 4.93
    Sequence mseakelikkmcdlqnsneeiqkemagwsgvvqykldgeefyveyksdgtcefkegvhssptftvvapp dfwlavlkgqedpvsgfmmgkyriegnimeaqrlagvikkfqgkfel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.22195
    Matthews' coefficent 2.09 Rfactor 0.18304
    Waters 89 Solvent Content 41.25

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cnu
    1. Differences in the structure and dynamics of the apo-and palmitate-ligated forms of Aedes aegypti sterol carrier protein 2 (AeSCP-2)
    KK Singarapu, JT Radek, M Tonelli, JL Markley - Journal of Biological , 2010 - ASBMB
     
    2. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch