The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of Sigma-54 interaction domain of putative transcriptional response regulator from Neisseria gonorrhoeae. To be Published
    Site MCSG
    PDB Id 3co5 Target Id APC89341.1
    Molecular Characteristics
    Source Neisseria gonorrhoeae fa 1090
    Alias Ids TPS5950,AAW90486.1,, 242231 Molecular Weight 15218.54 Da.
    Residues 140 Isoelectric Point 5.89
    Sequence fdklgnsaaiqemnreveaaakrtspvfltgeagspfetvaryfhkngtpwvsparveylidmpmellq kaeggvlyvgdiaqysrniqtgitfiigkaercrvrviascsyaagsdgisceeklaglfsesvvripp ls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.241
    Matthews' coefficent 2.77 Rfactor 0.205
    Waters 25 Solvent Content 55.54

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch