.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cp3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the conserved protein of unknown function DIP1874 from Corynebacterium diphtheriae. To be Published
    Site MCSG
    PDB Id 3cp3 Target Id APC82846
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS5691,CAE50403.1, 1717 Molecular Weight 16553.76 Da.
    Residues 145 Isoelectric Point 4.74
    Sequence mmgimsdpitildssdslsrlssesvgrlvvhrkddldifpvnfvldysaeqprvyfrtaegtklfsvn lnsdvlfevdrfddaegwsvvlkgnayvvrdteearhadtlglkpwlptlkynfvridvrevsgrafvf geepery
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.229
    Matthews' coefficent 2.59 Rfactor 0.188
    Waters 78 Solvent Content 52.48

    Ligand Information
    Ligands ACY (ACETIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 3cp3
    1. The structure of a Xanthomonas general stress protein involved in citrus canker reveals its flavin-binding property
    E Hilario, Y Li, D Niks, L Fan - Acta Crystallographica Section D: , 2012 - scripts.iucr.org
     
    2. Uniquemer Algorithm for Identification of Conserved and Unique Subsequences
    SN Gardner, TA Kuczmarski - US Patent App. 12/051,766, 2008 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch